PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G01950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1651aa    MW: 179114 Da    PI: 6.9902
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G01950.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.5e-07798840347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  OGLUM05G01950.1 798 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 840
                      899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-13781843IPR009057Homeodomain-like
PROSITE profilePS5129314.547794845IPR017884SANT domain
SMARTSM007174.8E-7795843IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5798842IPR009057Homeodomain-like
PfamPF002499.7E-6798840IPR001005SANT/Myb domain
PROSITE profilePS5129313.72810031054IPR017884SANT domain
SMARTSM007176.6E-410041052IPR001005SANT/Myb domain
SuperFamilySSF466891.48E-810081054IPR009057Homeodomain-like
CDDcd001670.0012710081046No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1651 aa     Download sequence    Send to blast
MPPPPPDRRD FLYRDGRRHD GDPLPPPAPT PPRWRDSPYH PPPPPPPLRD HSRPSPRRTP  60
SSASSGRPFA HKSSDLMLPP PPPPPWTSPP PLIRRNRSAI SDGYYRQGGG SYDRSYPDES  120
LGYTPSRSDR YWLDDDGGGG GYKGFSRYGG GGGGGSRRDG RDMRGSYRRS PFRGYGSDFS  180
RNQQEHPPPP LRRSPLRSVA VPMSYDPPGD RADRGDRDHH HRVTPWRPLR RRESRSDAAD  240
AAGAGPVPVG QAAAAAASEK DVSARSSAVA APQVSEEEAP RKKPRLGWGQ GLAKYEKQKV  300
QGPAESAEAV AEGSPTATEQ KGITHTPAPA PCVSPVAAPS PAPCASPVAA PSPAPPCKSP  360
VPEDKSCELT ANTVTESNKN IPGPDVQACN NEVPTKLDQL EGDPIDSLAK VLSELVQHED  420
SCSGDSKRLS NVSKLLLLKE SISKELEKTE LEIDSLEGEL KSVNVEARNR TLKDPPTAVT  480
YAQNPSPSPV KEQGELTPSP KISMEQDADV KGSELMEVET AQAHNAKAVS SEESVACPGV  540
APGQVPAAAD VIPSDPCGKT GSGIDVDIEQ REENPCQENF NAMKADGSSD LATRPCSYRD  600
VKYNLMDQII AANRSEAKKN SQLLCKPVPA DRSNLDLLAS SYLSSQMKND VIIKKKHAIL  660
KNRQRFKEQI LTFKFRVLRH LWKEDVRLLS VRKQRSKSHK RTDQSNRSSQ SGSQRQRSSN  720
RSRLAVPAGN LSTFPITEMS GVARKLFSEF QLKRCRNYLK MPALIVDEKE KAGAKFVSKN  780
GLVEDPVSVE KERALINPWI QEEKEIFMEK LATFGKDFSK ISSFLQHKTT ADCIEFYYKH  840
HKSDSFREVK KLLDLRQQQQ PASNYLGAVS GKKWNPEANA ASLDMLGVAT EVAAQGLEYV  900
NEVKKNSAKS ILRTVCGVDN STKGSEKDCV GDVSLHERES VAADVLAGIC GTLSPEGMGS  960
CITSSADPGQ KIGIISRMEH LLIPEADKNF DDDGTLSDQE CEVDIVDWND DEKSSFIEAM  1020
NRYGKDFARI SSYVKSKSFE QCKVFFSKAR KSLGLDLIHQ GAADAGFPTG DANGGRSGTD  1080
GACIAEMDSA ICSAQSCPKV EIDACPVSDG EIQGHNPLSD IASRQPEADK SNMPDVVDIN  1140
VEEGESKAEK DCSILVDHKQ LREDINQTSC ARIDINCPES TDKLQDIEDV TPVNMHGDDL  1200
MATSVEQVAA AHVESRSSLH SEGIGIDVSR IEGCSHESTI GKGGKSTPSV CLPAENGVSK  1260
ENIIHFSNMD GASSISPAFT SNYQQSKLAD PIQSKPKPLT PKDLMPVQFS SSLPDPTSIC  1320
FEGIAAITTP NFEDHGNRAS IASGAKDVNM FPTFKDQSSN RHDALFSNVD GYRQQRRNNH  1380
FGTEVCGLSE STGISQSDQF TVSKFQNGRP SSLGLLNGNL GVLSTGRREE AREGLFRPCS  1440
VKTSAGNEEQ QKRPGDVKLF GQILSHQSSL QSSGSSVHGS KSKPPSPKVD KPASSRLLSN  1500
PRERLVYSSR PPIIANLGLE ERAMRSFDHM DGRTIQPEPM VMVAKCQRPS AGVPVYSTKN  1560
GALSVFAEFQ QPSMPPHTSD HKLLENFADL HKRNGIELLS GFQQPGRLGG AGVLVSGVSD  1620
PVAALKAQYG SGSKMLSSSN DVDTWKDIGS R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-16756847494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-16756847494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297200.0AC129720.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0683F12, complete sequence.
GenBankAC1349310.0AC134931.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0079L11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA0A0D9ZTP60.0A0A0D9ZTP6_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.15e-75MYB family protein